PDB entry 1m1x

View 1m1x on RCSB PDB site
Description: crystal structure of the extracellular segment of integrin alpha vbeta3 bound to mn2+
Deposited on 2002-06-20, released 2002-08-14
The last revision prior to the SCOP 1.61 freeze date was dated 2002-08-14, with a file datestamp of 2002-08-14.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.244
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m1xA (A:)
    fnldvdspaeysgpegsyfgfavdffvpsassrmfllvgapkanttqpgiveggqvlkcd
    wsstrrcqpiefdatgnrdyakddplefkshqwfgasvrskqdkilacaplyhwrtemkq
    erepvgtcflqdgtktveyapcrsqdidadgqgfcqggfsidftkadrvllggpgsfywq
    gqlisdqvaeivskydpnvysikynnqlatrtaqaifddsylgysvavgdfngdgiddfv
    sgvpraartlgmvyiydgknmsslynftgeqmaayfgfsvaatdingddyadvfigaplf
    mdrgsdgklqevgqvsvslqrasgdfqttklngfevfarfgsaiaplgdldqdgfndiai
    aapyggedkkgivyifngrstglnavpsqilegqwaarsmppsfgysmkgatdidkngyp
    dlivgafgvdrailyrarpvitvnaglevypsilnqdnktcslpgtalkvscfnvrfclk
    adgkgvlprklnfqvellldklkqkgairralflysrspshsknmtisrgglmqceelia
    ylrdesefrdkltpitifmeyrldyrtaadttglqpilnqftpanisrqahilldcgedn
    vckpklevsvdsdqkkiyigddnpltlivkaqnqgegayeaelivsiplqadfigvvrnn
    ealarlscafktenqtrqvvcdlgnpmkagtqllaglrfsvhqqsemdtsvkfdlqiqss
    nlfdkvspvvshkvdlavlaaveirgvsspdhvflpipnwehkenpeteedvgpvvqhiy
    elrnngpssfskamlhlqwpykynnntllyilhydidgpmnctsdmeinplrikisslqt
    tekndtvagqgerdhlitkrdlalsegdihtlgcgvaqclkivcqvgrldrgksailyvk
    sllwtetfmnkenqnhsyslkssasfnviefpyknlpieditnstlvttnvtwgiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m1xA (A:)
    fnldvdspaeysgpegsyfgfavdffvpsassrmfllvgapkanttqpgiveggqvlkcd
    wsstrrcqpiefdatgnrdyakddplefkshqwfgasvrskqdkilacaplyhwrtemkq
    erepvgtcflqdgtktveyapcrsqdidadgqgfcqggfsidftkadrvllggpgsfywq
    gqlisdqvaeivskydpnvysikynnqlatrtaqaifddsylgysvavgdfngdgiddfv
    sgvpraartlgmvyiydgknmsslynftgeqmaayfgfsvaatdingddyadvfigaplf
    mdrgsdgklqevgqvsvslqrasgdfqttklngfevfarfgsaiaplgdldqdgfndiai
    aapyggedkkgivyifngrstglnavpsqilegqwaarsmppsfgysmkgatdidkngyp
    dlivgafgvdrailyrarpvitvnaglevypsilnqdnktcslpgtalkvscfnvrfclk
    adgkgvlprklnfqvellldklkqkgairralflysrspshsknmtisrgglmqceelia
    ylrdesefrdkltpitifmeyrldyrtaadttglqpilnqftpanisrqahilldcgedn
    vckpklevsvdsdqkkiyigddnpltlivkaqnqgegayeaelivsiplqadfigvvrnn
    ealarlscafktenqtrqvvcdlgnpmkagtqllaglrfsvhqqsemdtsvkfdlqiqss
    nlfdkvspvvshkvdlavlaaveirgvsspdhvflpipnwehkenpeteedvgpvvqhiy
    elrnngpssfskamlhlqwpykynnntllyilhydidgpmnctsdmeinplrikissldi
    htlgcgvaqclkivcqvgrldrgksailyvksllwtetfmnkenqnhsyslkssasfnvi
    efpyknlpieditnstlvttnvtwgiq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1m1xB (B:)
    efpvsearvledrplsdkgsgdssqvtqvspqrialrlrpddsknfsiqvrqvedypvdi
    yylmdlsysmkddlwsiqnlgtklatqmrkltsnlrigfgafvdkpvspymyisppeale
    npcydmkttclpmfgykhvltltdqvtrfneevkkqsvsrnrdapeggfdaimqatvcde
    kigwrndashllvfttdakthialdgrlagivqpndgqchvgsdnhysasttmdypslgl
    mteklsqkninlifavtenvvnlyqnyselipgttvgvlsmdssnvlqlivdaygkirsk
    velevrdlpeelslsfnatclnnevipglkscmglkigdtvsfsieakvrgcpqekeksf
    tikpvgfkdslivqvtfdcdcacqaqaepnshrcnngngtfecgvcrcgpgwlgsqcecs
    eedyrpsqqdecspregqpvcsqrgeclcgqcvchssdfgkitgkycecddfscvrykge
    mcsghgqcscgdclcdsdwtgyycncttrtdtcmssngllcsgrgkcecgscvciqpgsy
    gdtcekcptcpdactfkkecveckkfdrepymtentcnrycrdeiesvkelkdtgkdavn
    ctykneddcvvrfqyyedssgksilyvveepecpkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m1xB (B:)
    efpvsearvledrplsdkgsgdssqvtqvspqrialrlrpddsknfsiqvrqvedypvdi
    yylmdlsysmkddlwsiqnlgtklatqmrkltsnlrigfgafvdkpvspymyisppeale
    npcydmkttclpmfgykhvltltdqvtrfneevkkqsvsrnrdapeggfdaimqatvcde
    kigwrndashllvfttdakthialdgrlagivqpndgqchvgsdnhysasttmdypslgl
    mteklsqkninlifavtenvvnlyqnyselipgttvgvlsmdssnvlqlivdaygkirsk
    velevrdlpeelslsfnatclnnevipglkscmglkigdtvsfsieakvrgcpqekeksf
    tikpvgfkdslivqvtfdcdkgemcsghgqcscgdclcdsdwtgyycncttrtdtcmssn
    gllcsgrgkcecgscvciqpgsygdtcekcptcpdactfkkecveckkfdrepymtentc
    nrycrdeiesvkelkdtgkdavnctykneddcvvrfqyyedssgksilyvveepecpkg