PDB entry 1m1u

View 1m1u on RCSB PDB site
Description: an isoleucine-based allosteric switch controls affinity and shape shifting in integrin cd11b a-domain
Class: cell adhesion
Keywords: INTEGRIN, CELL ADHESION PROTEIN, GLYCOPROTEIN, A-domain, CD11b
Deposited on 2002-06-20, released 2002-08-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.188
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Integrin alpha-M
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1m1ua_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m1uA (A:)
    gsealrgspqedsdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseef
    rihftfkefqnnpnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvi
    tdgekfgdplgyedvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvn
    nfealktiqnqlrek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m1uA (A:)
    dsdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftfkefqn
    npnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekfgdplg
    yedvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvnnfealktiqnq
    lrek