PDB entry 1m1r

View 1m1r on RCSB PDB site
Description: Reduced p222 crystal structure of the tetraheme cytochrome c of Shewanella oneidensis MR1
Class: electron transport
Keywords: reduced structure, atomic resolution, ELECTRON TRANSPORT
Deposited on 2002-06-20, released 2002-08-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-03-03, with a file datestamp of 2021-02-26.
Experiment type: XRAY
Resolution: 1.02 Å
R-factor: N/A
AEROSPACI score: 0.9 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: small tetraheme cytochrome c
  Species: Shewanella oneidensis [TaxId:70863]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8EDL6 (0-90)
  Domains in SCOPe 2.08: d1m1ra_
• Heterogens: SO4, HEC, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1m1rA (A:)
  adqklsdfhaesggceschkdgtpsadgafefaqcqschgklsemdavhkphdgnlvcad
  chavhdmnvgqkptceschddgrtsasvlkk