PDB entry 1m1n

View 1m1n on RCSB PDB site
Description: Nitrogenase MoFe protein from Azotobacter vinelandii
Class: oxidoreductase
Keywords: atomic resolution, FeMo cofactor, nitrogen fixation, central nitrogen ligand, OXIDOREDUCTASE
Deposited on 2002-06-19, released 2002-09-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-05-05, with a file datestamp of 2009-05-01.
Experiment type: XRAY
Resolution: 1.16 Å
R-factor: 0.123
AEROSPACI score: 0.8 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrogenase molybdenum-iron protein alpha chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m1na_
  • Chain 'B':
    Compound: nitrogenase molybdenum-iron protein beta chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m1nb_
  • Chain 'C':
    Compound: nitrogenase molybdenum-iron protein alpha chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m1nc_
  • Chain 'D':
    Compound: nitrogenase molybdenum-iron protein beta chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m1nd_
  • Chain 'E':
    Compound: nitrogenase molybdenum-iron protein alpha chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m1ne_
  • Chain 'F':
    Compound: nitrogenase molybdenum-iron protein beta chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m1nf_
  • Chain 'G':
    Compound: nitrogenase molybdenum-iron protein alpha chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m1ng_
  • Chain 'H':
    Compound: nitrogenase molybdenum-iron protein beta chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m1nh_
  • Heterogens: CA, HCA, CLF, CFN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m1nA (A:)
    tgmsreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirg
    cayagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqek
    divfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpv
    rcegfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssril
    leemglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffg
    ptktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrpr
    hvigayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdli
    gsgikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwea
    segaekvaasa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m1nA (A:)
    msreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgca
    yagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekdi
    vfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrc
    egfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrille
    emglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgpt
    ktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhv
    igayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligs
    gikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m1nB (B:)
    sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
    ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
    aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
    pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
    rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
    kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
    lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknatv
    yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
    sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1m1nC (C:)
    tgmsreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirg
    cayagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqek
    divfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpv
    rcegfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssril
    leemglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffg
    ptktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrpr
    hvigayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdli
    gsgikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwea
    segaekvaasa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m1nC (C:)
    msreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgca
    yagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekdi
    vfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrc
    egfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrille
    emglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgpt
    ktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhv
    igayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligs
    gikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m1nD (D:)
    sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
    ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
    aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
    pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
    rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
    kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
    lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknatv
    yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
    sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1m1nE (E:)
    tgmsreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirg
    cayagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqek
    divfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpv
    rcegfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssril
    leemglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffg
    ptktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrpr
    hvigayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdli
    gsgikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwea
    segaekvaasa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m1nE (E:)
    msreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgca
    yagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekdi
    vfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrc
    egfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrille
    emglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgpt
    ktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhv
    igayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligs
    gikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m1nF (F:)
    sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
    ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
    aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
    pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
    rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
    kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
    lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknatv
    yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
    sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1m1nG (G:)
    tgmsreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirg
    cayagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqek
    divfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpv
    rcegfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssril
    leemglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffg
    ptktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrpr
    hvigayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdli
    gsgikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwea
    segaekvaasa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m1nG (G:)
    msreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgca
    yagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekdi
    vfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrc
    egfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrille
    emglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgpt
    ktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhv
    igayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligs
    gikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m1nH (H:)
    sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
    ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
    aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
    pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
    rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
    kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
    lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknatv
    yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
    sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr