PDB entry 1m1m

View 1m1m on RCSB PDB site
Description: x-ray crystal structure of mycobacterium tuberculosis beta-ketoacyl-acyl carrier protein synthase III (mtfabh)
Class: transferase
Keywords: 3-oxoacyl-acyl carrier protein synthase III, mtFabH, condensing enzyme, alpha-beta-alpha-beta-alpha, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, TRANSFERASE
Deposited on 2002-06-19, released 2002-07-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.212
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase III
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: Rv0533c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1m1ma1, d1m1ma2
  • Chain 'B':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase III
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: Rv0533c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1m1mb1, d1m1mb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m1mA (A:)
    mgsshhhhhhssglvprgshmteiattsgarsvgllsvgayrpervvtndeicqhidssd
    ewiytrtgiktrrfaaddesaasmateacrralsnaglsaadidgvivttnthflqtppa
    apmvaaslgakgilgfdlsagcagfgyalgaaadmirgggaatmlvvgteklsptidmyd
    rgncfifadgaaavvvgetpfqgigptvagsdgeqadairqdidwitfaqnpsgprpfvr
    legpavfrwaafkmgdvgrramdaagvrpdqidvfvphqansrinellvknlqlrpdavv
    andiehtgntsaasiplamaellttgaakpgdlalligygaglsyaaqvvrmpkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m1mA (A:)
    mteiattsgarsvgllsvgayrpervvtndeicqhidssdewiytrtgiktrrfaaddes
    aasmateacrralsnaglsaadidgvivttnthflqtppaapmvaaslgakgilgfdlsa
    gcagfgyalgaaadmirgggaatmlvvgteklsptidmydrgncfifadgaaavvvgetp
    fqgigptvagsdgeqadairqdidwitfaqnpsgprpfvrlegpavfrwaafkmgdvgrr
    amdaagvrpdqidvfvphqansrinellvknlqlrpdavvandiehtgntsaasiplama
    ellttgaakpgdlalligygaglsyaaqvvrm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1m1mB (B:)
    mgsshhhhhhssglvprgshmteiattsgarsvgllsvgayrpervvtndeicqhidssd
    ewiytrtgiktrrfaaddesaasmateacrralsnaglsaadidgvivttnthflqtppa
    apmvaaslgakgilgfdlsagcagfgyalgaaadmirgggaatmlvvgteklsptidmyd
    rgncfifadgaaavvvgetpfqgigptvagsdgeqadairqdidwitfaqnpsgprpfvr
    legpavfrwaafkmgdvgrramdaagvrpdqidvfvphqansrinellvknlqlrpdavv
    andiehtgntsaasiplamaellttgaakpgdlalligygaglsyaaqvvrmpkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m1mB (B:)
    iattsgarsvgllsvgayrpervvtndeicqhidssdewiytrtgiktrrfaaddesaas
    mateacrralsnaglsaadidgvivttnthflqtppaapmvaaslgakgilgfdlsagca
    gfgyalgaaadmirgggaatmlvvgteklsptidmydrgncfifadgaaavvvgetpfqg
    igptvagsdgeqadairqdidwitfaqnpsgprpfvrlegpavfrwaafkmgdvgrramd
    aagvrpdqidvfvphqansrinellvknlqlrpdavvandiehtgntsaasiplamaell
    ttgaakpgdlalligygaglsyaaqvvrm