PDB entry 1m1k

View 1m1k on RCSB PDB site
Description: Co-crystal structure of azithromycin bound to the 50S ribosomal subunit of Haloarcula marismortui
Class: ribosome
Keywords: 50S, ribosome, azithromycin, macrolide, Haloarcula
Deposited on 2002-06-19, released 2002-07-19
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.214
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: ribosomal protein l37ae
    Species: Haloarcula marismortui [TaxId:2238]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1M1K (0-72)
    Domains in SCOPe 2.01: d1m1k1_
  • Chain '2':
    Compound: ribosomal protein l37e
    Species: Haloarcula marismortui [TaxId:2238]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1m1k2_
  • Chain '3':
    Compound: ribosomal protein l39e
    Species: Haloarcula marismortui [TaxId:2238]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1m1k3_
  • Chain '4':
    Compound: ribosomal protein l44e
    Species: Haloarcula marismortui [TaxId:2238]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1m1k4_
  • Chain 'A':
    Compound: 23s rRNA
    Species: Haloarcula marismortui [TaxId:2238]
    Gene:
  • Chain 'B':
    Compound: 5s rRNA
    Species: Haloarcula marismortui [TaxId:2238]
    Gene:
  • Chain 'C':
    Compound: ribosomal protein l2
    Species: Haloarcula marismortui [TaxId:2238]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1m1kc1, d1m1kc2
  • Chain 'D':
    Compound: ribosomal protein l3
    Species: Haloarcula marismortui [TaxId:2238]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20279 (0-336)
      • conflict (309)
    Domains in SCOPe 2.01: d1m1kd_
  • Chain 'E':
    Compound: ribosomal protein l4
    Species: Haloarcula marismortui [TaxId:2238]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1m1ke_
  • Chain 'F':
    Compound: ribosomal protein l5
    Species: Haloarcula marismortui [TaxId:2238]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1m1kf_
  • Chain 'G':
    Compound: ribosomal protein l6
    Species: Haloarcula marismortui [TaxId:2238]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1m1kg1, d1m1kg2
  • Chain 'H':
    Compound: ribosomal protein l7ae
    Species: Haloarcula marismortui [TaxId:2238]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1m1kh_
  • Chain 'I':
    Compound: ribosomal protein l10
    Species: Haloarcula marismortui [TaxId:2238]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1m1ki_
  • Chain 'J':
    Compound: ribosomal protein l10e
    Species: Haloarcula marismortui [TaxId:2238]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1M1K (0-166)
    Domains in SCOPe 2.01: d1m1kj_
  • Chain 'K':
    Compound: ribosomal protein l13
    Species: Haloarcula marismortui [TaxId:2238]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1m1kk_
  • Chain 'L':
    Compound: ribosomal protein l14
    Species: Haloarcula marismortui [TaxId:2238]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1m1kl_
  • Chain 'M':
    Compound: ribosomal protein l15
    Species: Haloarcula marismortui [TaxId:2238]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1m1km_
  • Chain 'N':
    Compound: ribosomal protein l15e
    Species: Haloarcula marismortui [TaxId:2238]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1M1K (0-193)
    Domains in SCOPe 2.01: d1m1kn_
  • Chain 'O':
    Compound: ribosomal protein l18
    Species: Haloarcula marismortui [TaxId:2238]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1m1ko_
  • Chain 'P':
    Compound: ribosomal protein l18e
    Species: Haloarcula marismortui [TaxId:2238]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1m1kp_
  • Chain 'Q':
    Compound: ribosomal protein l19e
    Species: Haloarcula marismortui [TaxId:2238]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14119 (0-End)
      • conflict (70)
    Domains in SCOPe 2.01: d1m1kq_
  • Chain 'R':
    Compound: ribosomal protein l21e
    Species: Haloarcula marismortui [TaxId:2238]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1m1kr_
  • Chain 'S':
    Compound: ribosomal protein l22
    Species: Haloarcula marismortui [TaxId:2238]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1m1ks_
  • Chain 'T':
    Compound: ribosomal protein l23
    Species: Haloarcula marismortui [TaxId:2238]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1m1kt_
  • Chain 'U':
    Compound: ribosomal protein l24
    Species: Haloarcula marismortui [TaxId:2238]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1m1ku_
  • Chain 'V':
    Compound: ribosomal protein l24e
    Species: Haloarcula marismortui [TaxId:2238]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1m1kv_
  • Chain 'W':
    Compound: ribosomal protein l29
    Species: Haloarcula marismortui [TaxId:2238]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1m1kw_
  • Chain 'X':
    Compound: ribosomal protein l30
    Species: Haloarcula marismortui [TaxId:2238]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1m1kx_
  • Chain 'Y':
    Compound: ribosomal protein l31e
    Species: Haloarcula marismortui [TaxId:2238]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1m1ky_
  • Chain 'Z':
    Compound: ribosomal protein l32e
    Species: Haloarcula marismortui [TaxId:2238]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1m1kz_
  • Heterogens: ZIT, MG, K, NA, CL, CD, HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m1k1 (1:)
    rtgrfgpryglkirvrvadveikhkkkhkcpvcgfkklkragtgiwmcghcgykiaggcy
    qpetvagkavmka
    

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m1k2 (2:)
    tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage
    

  • Chain '3':
    Sequence, based on SEQRES records: (download)
    >1m1k3 (3:)
    gkkskatkkrlakldnqnsrvpawvmlktdevqrnhkrrhwrrndtde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m1k3 (3:)
    gkkskatkkrlakldnqnsrvpawvmlktdernhkrrhwrrndtde
    

  • Chain '4':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m1k4 (4:)
    mqmprrfntycphcnehqehevekvrsgrqtgmkwidrqrernsgigndgkfskvpggdk
    ptkktdlkyrcgecgkahlregwragrlefqe
    

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1m1kC (C:)
    grriqgqrrgrgtstfrapshrykadlehrkvedgdviagtvvdiehdparsapvaavef
    edgdrrlilapegvgvgdelqvgvdaeiapgntlplaeipegvpvcnvesspgdggkfar
    asgvnaqllthdrnvavvklpsgemkrldpqcratigvvggggrtdkpfvkagnkhhkmk
    argtkwpnvrgvamnavdhpfggggrqhpgkpksisrnappgrkvgdiaskrtgrggne
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m1kC (C:)
    grriqgqrrgrgtstfrapshrykadlehrkvedgdviagtvvdiehdparsapvaavef
    edgdrrlilapegvgvgdelqvgvdaeiapgntlplaeipegvpvcnvesspgdggkfar
    asgvnaqllthdrnvavvklpsgemkrldpqcratigvvggggrtdkpfvkagnkhhkmk
    argtkwpnvrgvamnavdhpfggggrqhpgkpksisrnappgrkvgdiaskrtgrgg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m1kD (D:)
    pqpsrprkgslgfgprkrstsetprfnswpsddgqpgvqgfagykagmthvvlvndepns
    pregmeetvpvtvietppmravalrayedtpygqrpltevwtdefhseldrtldvpedhd
    pdaaeeqirdaheagdlgdlrlithtvpdavpsvpkkkpdvmetrvgggsvsdrldhald
    ivedggehamndifrageyadvagvtkgkgtqgpvkrwgvqkrkgkharqgwrrrignlg
    pwnpsrvrstvpqqgqtgyhqrtelnkrlidigegdeptvdggfvnygevdgpytlvkgs
    vpgpdkrlvrfrpavrpndqprldpevryvsnesnqg
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m1kE (E:)
    mqatiydldgntdgevdlpdvfetpvrsdligkavraaqanrkqdygsdeyaglrtpaes
    fgsgrgqahvpkldgrarrvpqavkgrsahppktekdrsldlndkerqlavrsalaatad
    adlvadrghefdrdevpvvvsddfedlvktqevvsllealdvhadidradetkikagqgs
    argrkyrrpasilfvtsdepstaarnlagadvatasevntedlapggapgrltvftesal
    aevaer
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1m1kF (F:)
    ssesesggdfhemrepriekvvvhmgighggrdlanaedilgeitgqmpvrtkakrtvge
    fdiregdpigakvtlrdemaeeflqtalplaelatsqfddtgnfsfgveehtefpsqeyd
    psigiygldvtvnlvrpgyrvakrdkasrsiptkhrlnpadavafiestydvevse
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m1kF (F:)
    fhemrepriekvvvhmgighanaedilgeitgqmpvrtkakrtvgefdiregdpigakvt
    lrdemaeeflqtalplaelatsqfddtgnfsfgldvtvnlvrpgyrvakrdkasrsiptk
    hrlnpadavafiestydvev
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1m1kG (G:)
    prveleipedvdaeqdhlditvegdngsvtrrlwypdidvsvdgdtvviesdednaktms
    tigtfqshienmfhgvtegweygmevfyshfpmqvnvegdevvienflgekaprrttihg
    dtdveidgeeltvsgpdieavgqtaadieqltrindkdvrvfqdgvyitrkpnrgda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m1kG (G:)
    prveleipedvdaeqdhlditvegdngsvtrrlwypdidvsvdgdtvviesdednaktms
    tigtfqshienmfhgvtegweygmevfyshfpmqvnvegdevvienflgekaprrttihg
    dtdveidgeeltvsgpdieavgqtaadieqltrindkdvrvfqdgvyitrkp
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m1kH (H:)
    pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv
    mhipeladekgvpfifveqqddlghaaglevgsaaaavtdagaaatvleeiadkveelr
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1m1kI (I:)
    msaeserktetipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelr
    vsrntlleralddvddgledlngyitgqvgligtddnpfslfqeleasktpapigageva
    pndivipegdtgvdpgpfvgelqsvgadariqegsiqvlsdstvldtgeevsqelsnvln
    elgiepkevgldlravfadgvlfepeeleldideyrsdiqaaagrafnlsvnadyptatt
    aptmlqsdrgnakslalqaaiedpevvpdlvskadaqvralasqiddeealpeelqgvea
    dvateeptddqdddtaseddadaddaaeeadddddddedagdalgamf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m1kI (I:)
    ipewkqeevdaivemiesrntlleraldd
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1m1kJ (J:)
    kpgamyrnsskpaytrreyisgipgkkiaqfdmgnngagptypaqvelvvekpvqirhna
    leaarvaanryvqnsgaaanykfrirkfpfhvirenkaaaaaaaaaaadgmrapfgkpvg
    taarvhganhifiawvnpdpnveeawrrakmkvtptinidsspagna
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m1kJ (J:)
    kpgamyrnsskpaytrreyisgipgkkiaqfdmgnngagptypaqvelvvekpvqirhna
    leaarvaanryvqnsgaaanykfrirkfpfhvirenkdgmrapfgkpvgtaarvhganhi
    fiawvnpdpnveeawrrakmkvtptinidsspagna
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1m1kK (K:)
    msvaefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekr
    vdigndngyfypkrpdgifkrtirgmlphkkqrgreafesvrvylgnpydedgevldgts
    ldrlsnikfvtlgeisetlganktw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m1kK (K:)
    aefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekrvdi
    gndngyfypkrpdgifkrtirgmlphkkqrgreafesvrvylgnpydedgevldgtsldr
    lsnikfvtlgeisetlganktw
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m1kL (L:)
    mealgadvtqglekgslitcadntgarelkvisvhgysgtknrhpkaglgdkitvsvtkg
    tpemrrqvleavvvrqrkpirrpdgtrvkfednaavivdenedprgtelkgpiarevaqr
    fgsvasaatmiv
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1m1kM (M:)
    tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee
    aatidvreidenvtllaaddvaevedggfrvdvrdvveeaddadyvkvlgagqvrheltl
    iaddfsegarekvegaggsveltdlgeerqaeaeetedadadee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m1kM (M:)
    tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee
    aatidvreidenvtllaaddvaefrvdvrdvveeaddadyvkvlgagqvrheltliaddf
    segarekvegaggsveltdlgeerq
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m1kN (N:)
    arsaysyireawkrpkegqiaelmwhrmqewrnepavvrierptrldrarslgykakqgi
    ivvrvairkgssrrtrfnkgrrskrmmvnritrkkniqriaeeranrkfpnlrvlnsysv
    gedgrhkwhevilidpdhpaiksddqlswisrtrhrlrtfrgltsagrrcrglrgqgkgs
    ekvrpslrvngaka
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m1kO (O:)
    atgprykvpmrrrreartdyhqrlrllksgkprlvarksnkhvraqlvtlgpngddtlas
    ahssdlaeygweaptgnmpsayltgllaglraqeagveeavldiglnsptpgskvfaiqe
    gaidagldiphnddvladwqrtrgahiaeydeqleeplysgdfdaadlpehfdelretll
    dgdiel
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m1kP (P:)
    sktnprlssliadlksaarssggavwgdvaerlekprrthaevnlgrieryaqedetvvv
    pgkvlgsgvlqkdvtvaavdfsgtaetkidqvgeavsleqaiennpegshvrvir
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >1m1kQ (Q:)
    tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
    rarerqkkrakghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
    dlydkagggefdsvadleryidanhgda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m1kQ (Q:)
    tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
    rarerqkkrakghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
    dlydkagggefdsvadleryida
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m1kR (R:)
    pssngplegtrgklknkprdrgtsppqraveefddgekvhlkidpsvpngrfhprfdgqt
    gtvegkqgdaykvdivdggkektiivtaahlrrqe
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1m1kS (S:)
    gisysveadpdttakamlrerqmsfkhskaiareikgktageavdyleaviegdqpvpfk
    qhnsgvghkskvdgwdagrypekaskafldllenavgnadhqgfdgeamtikhvaahkvg
    eqqgrkpramgrasawnspqvdvelileepeved
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m1kS (S:)
    gisysveadpdttakamlrerqmsfkhskaiareikgktageavdyleaviegdqpvpfk
    qhnsgvghkskvdgwdagrypekaskafldllenavgnadhqgfdgeamtikhvaahkvg
    eqqgrkpramgrasawnspqvdvelileep
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1m1kT (T:)
    swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
    ekkavvrlsedddaqevasrigvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m1kT (T:)
    swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
    ekkavvrlsedddaqevasri
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m1kU (U:)
    skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg
    evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearleseddsa
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >1m1kV (V:)
    prtrecdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtargeag
    eaedea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m1kV (V:)
    recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >1m1kW (W:)
    tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
    geegdlqene
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m1kW (W:)
    tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
    geegd
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m1kX (X:)
    mhalvqlrgevnmhtdiqdtlemlnihhvnhctlvpetdayrgmvakvndfvafgepsqe
    tletvlatraeplegdadvddewvaehtdyddisglafallseettlreqglsptlrlhp
    prgghdgvkhpvkeggqlgkhdtegiddlleamr
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >1m1kY (Y:)
    sasdfeervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawa
    rgrantpskirvraarfeeegeaiveaetae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m1kY (Y:)
    ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant
    pskirvraarfeeegeaiveae
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >1m1kZ (Z:)
    adneedveaeeeyteltdisgvgpskaeslreagfesvedvrgadqsaladvsgignala
    arikadvggleveseteaeveeeggeeapdedvetelqargltektpdlsdedarlltqr
    hrvgkpqfnrqdhhkkkrvstswrkprgqlskqrrgikgkgdtveagfrsptavrgkhps
    gfeevrvhnvddlegvdgdteavriaskvgarkrerieeeaedagirvlnptyvevevse
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m1kZ (Z:)
    telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr
    rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr
    erieeeaedagirvlnptyvev