PDB entry 1m1d

View 1m1d on RCSB PDB site
Description: tetrahymena gcn5 with bound bisubstrate analog inhibitor
Deposited on 2002-06-18, released 2002-10-30
The last revision prior to the SCOP 1.67 freeze date was dated 2002-11-06, with a file datestamp of 2002-11-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.213
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1m1da_
  • Chain 'C':
    Domains in SCOP 1.67: d1m1dc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m1dA (A:)
    lldfdiltndgthrnmkllidlknifsrqlpkmpkeyivklvfdrhhesmvilknkqkvi
    ggicfrqykpqrfaevaflavtaneqvrgygtrlmnkfkdhmqkqnieylltyadnfaig
    yfkkqgftkehrmpqekwkgyikdydggtlmecyihpyvdygr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1m1dC (C:)
    lldfdiltndgthrnmkllidlknifsrqlpkmpkeyivklvfdrhhesmvilknkqkvi
    ggicfrqykpqrfaevaflavtaneqvrgygtrlmnkfkdhmqkqnieylltyadnfaig
    yfkkqgftkehrmpqekwkgyikdydggtlmecyihpyvdygr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m1dC (C:)
    ldfdiltndgthrnmkllidlknifsrqlpkmpkeyivklvfdrhhesmvilknkqkvig
    gicfrqykpqrfaevaflavtaneqvrgygtrlmnkfkdhmqkqnieylltyadnfaigy
    fkkqgftkehrmpqekwkgyikdydggtlmecyihpyvdygr