PDB entry 1m18

View 1m18 on RCSB PDB site
Description: ligand binding alters the structure and dynamics of nucleosomal dna
Deposited on 2002-06-18, released 2003-02-18
The last revision prior to the SCOP 1.63 freeze date was dated 2003-02-18, with a file datestamp of 2003-02-18.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.222
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1m18a_
  • Chain 'B':
    Domains in SCOP 1.63: d1m18b_
  • Chain 'C':
    Domains in SCOP 1.63: d1m18c_
  • Chain 'D':
    Domains in SCOP 1.63: d1m18d_
  • Chain 'E':
    Domains in SCOP 1.63: d1m18e_
  • Chain 'F':
    Domains in SCOP 1.63: d1m18f_
  • Chain 'G':
    Domains in SCOP 1.63: d1m18g_
  • Chain 'H':
    Domains in SCOP 1.63: d1m18h_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m18A (A:)
    phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqease
    aylvalfedtnlcaihakrvtimpkdiqlarrirgera
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m18B (B:)
    dniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvta
    mdvvyalkrqgrtlygfgg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m18C (C:)
    aktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardn
    kktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkt
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m18D (D:)
    trkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstits
    reiqtavrlllpgelakhavsegtkavtkytsak
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m18E (E:)
    kphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeas
    eaylvalfedtnlcaihakrvtimpkdiqlarrirgera
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m18F (F:)
    kvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrk
    tvtamdvvyalkrqgrtlygfgg
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m18G (G:)
    aktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardn
    kktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkk
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m18H (H:)
    trkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstits
    reiqtavrlllpgelakhavsegtkavtkytsak