PDB entry 1m17

View 1m17 on RCSB PDB site
Description: Epidermal Growth Factor Receptor tyrosine kinase domain with 4-anilinoquinazoline inhibitor erlotinib
Class: transferase
Keywords: TRANSFERASE, tyrosine kinase domain
Deposited on 2002-06-17, released 2002-09-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.251
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m17a_
  • Heterogens: AQ4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m17A (A:)
    gshmasgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelre
    atspkankeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdni
    gsqyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekey
    haeggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilek
    gerlpqppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhl
    psptdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m17A (A:)
    geapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspka
    nkeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyll
    nwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggk
    vpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpq
    ppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlmdeedm
    ddvvdadeylip