PDB entry 1m16

View 1m16 on RCSB PDB site
Description: Human Acidic Fibroblast Growth Factor. 141 Amino Acid Form with Amino Terminal His Tag and Leu 44 Replaced with Phe (L44F), Leu 73 Replaced with Val (L73V), Val 109 Replaced with Leu (V109L) and Cys 117 Replaced with Val (C117V).
Class: hormone/growth factor
Keywords: beta-trefoil, HORMONE/GROWTH FACTOR COMPLEX
Deposited on 2002-06-17, released 2003-08-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.221
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acidic fibroblast growth factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230 (6-End)
      • expression tag (6)
      • engineered (49)
      • engineered (78)
      • engineered (114)
      • engineered (122)
      • engineered' (122)
    Domains in SCOPe 2.06: d1m16a_
  • Chain 'B':
    Compound: acidic fibroblast growth factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230 (6-End)
      • expression tag (6)
      • engineered (49)
      • engineered (78)
      • engineered (114)
      • engineered (122)
      • engineered' (122)
    Domains in SCOPe 2.06: d1m16b_
  • Heterogens: SO4, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m16A (A:)
    hhhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqfqlsaesvgev
    yikstetgqylamdtdglvygsqtpneeclflerleenhyntyiskkhaeknwflglkkn
    gsvkrgprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m16A (A:)
    hhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqfqlsaesvgevy
    ikstetgqylamdtdglvygsqtpneeclflerleenhyntyiskkhaeknwflglkkng
    svkrgprthygqkailflplpv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1m16B (B:)
    hhhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqfqlsaesvgev
    yikstetgqylamdtdglvygsqtpneeclflerleenhyntyiskkhaeknwflglkkn
    gsvkrgprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m16B (B:)
    hhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqfqlsaesvgevy
    ikstetgqylamdtdglvygsqtpneeclflerleenhyntyiskkhaeknwflglkkng
    svkrgprthygqkailflplpv