PDB entry 1m16

View 1m16 on RCSB PDB site
Description: human acidic fibroblast growth factor. 141 amino acid form with amino terminal his tag and leu 44 replaced with phe (l44f), leu 73 replaced with val (l73v), val 109 replaced with leu (v109l) and cys 117 replaced with val (c117v).
Deposited on 2002-06-17, released 2003-08-05
The last revision prior to the SCOP 1.67 freeze date was dated 2003-08-05, with a file datestamp of 2003-08-05.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1m16a_
  • Chain 'B':
    Domains in SCOP 1.67: d1m16b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m16A (A:)
    hhhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqfqlsaesvgev
    yikstetgqylamdtdglvygsqtpneeclflerleenhyntyiskkhaeknwflglkkn
    gsvkrgprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m16A (A:)
    hhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqfqlsaesvgevy
    ikstetgqylamdtdglvygsqtpneeclflerleenhyntyiskkhaeknwflglkkng
    svkrgprthygqkailflplpv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1m16B (B:)
    hhhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqfqlsaesvgev
    yikstetgqylamdtdglvygsqtpneeclflerleenhyntyiskkhaeknwflglkkn
    gsvkrgprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m16B (B:)
    hhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqfqlsaesvgevy
    ikstetgqylamdtdglvygsqtpneeclflerleenhyntyiskkhaeknwflglkkng
    svkrgprthygqkailflplpv