PDB entry 1m15

View 1m15 on RCSB PDB site
Description: Transition state structure of arginine kinase
Class: transferase
Keywords: arginine kinase, creatine kinase, phosphagen kinase, transition state analog, adenosine triphosphate, transferase
Deposited on 2002-06-17, released 2002-12-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arginine kinase
    Species: Limulus polyphemus [TaxId:6850]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51541 (Start-356)
      • see remark 999 (102)
      • see remark 999 (111)
      • see remark 999 (115)
    Domains in SCOPe 2.07: d1m15a1, d1m15a2
  • Heterogens: NO3, MG, ARG, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m15A (A:)
    mvdqatldkleagfkklqeasdcksllkkhltkdvfdsiknkktgmgatlldviqsgven
    ldsgvgiyapdaesyrtfgplfdpiiddyhggfkltdkhppkqwgdintlvgldpagqfi
    istrvrcgrslqgypfnpcltaeqykemeekvsstlssmedelkgtyypltgmskatqqq
    liddhflfkegdrflqtanacrywptgrgifhndaktflvwvneedhlriismqkggdlk
    tvykrlvtavdniesklpfshddrfgfltfcptnlgttmrasvhiqlpklakdrkvledi
    askfnlqvrgtrgehteseggvydisnkrrlglteyqavremqdgilemikmekaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m15A (A:)
    vdqatldkleagfkklqeasdcksllkkhltkdvfdsiknkktgmgatlldviqsgvenl
    dsgvgiyapdaesyrtfgplfdpiiddyhggfkltdkhppkqwgdintlvgldpagqfii
    strvrcgrslqgypfnpcltaeqykemeekvsstlssmedelkgtyypltgmskatqqql
    iddhflfkegdrflqtanacrywptgrgifhndaktflvwvneedhlriismqkggdlkt
    vykrlvtavdniesklpfshddrfgfltfcptnlgttmrasvhiqlpklakdrkvledia
    skfnlqvrgtrgehteseggvydisnkrrlglteyqavremqdgilemikmekaaa