PDB entry 1m13

View 1m13 on RCSB PDB site
Description: Crystal Structure of the Human Pregane X Receptor Ligand Binding Domain in Complex with Hyperforin, a Constituent of St. John's Wort
Class: transcription
Keywords: nuclear receptor, ligand binding domain, protein-ligand complex, TRANSCRIPTION
Deposited on 2002-06-17, released 2003-03-04
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.212
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orphan nuclear receptor pxr
    Species: Homo sapiens [TaxId:9606]
    Gene: NR1I2 or PXR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1m13a_
  • Heterogens: HYF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m13A (A:)
    mkkghhhhhhgsertgtqplgvqglteeqrmmirelmdaqmktfdttfshfknfrlpgvl
    ssgcelpeslqapsreeaakwsqvrkdlcslkvslqlrgedgsvwnykppadsggkeifs
    llphmadmstymfkgiisfakvisyfrdlpiedqisllkgaafelcqlrfntvfnaetgt
    wecgrlsycledtaggfqqlllepmlkfhymlkklqlheeeyvlmqaislfspdrpgvlq
    hrvvdqlqeqfaitlksyiecnrpqpahrflflkimamltelrsinaqhtqrllriqdih
    pfatplmqelfgitgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m13A (A:)
    glteeqrmmirelmdaqmktfdttfshfknfrlpgvkwsqvrkdlcslkvslqlrgedgs
    vwnykppadsggkeifsllphmadmstymfkgiisfakvisyfrdlpiedqisllkgaaf
    elcqlrfntvfnaetgtwecgrlsycledtaggfqqlllepmlkfhymlkklqlheeeyv
    lmqaislfspdrpgvlqhrvvdqlqeqfaitlksyiecnrpqpahrflflkimamltelr
    sinaqhtqrllriqdihpfatplmqelfgitgs