PDB entry 1m0e

View 1m0e on RCSB PDB site
Description: zebularine: a novel DNA methylation inhibitor that forms a covalent complex with DNA methyltransferase
Class: transferase/DNA
Keywords: Protein-DNA covalent complex, Mechanism based DNA methylation inhibitors, Zebularine, TRANSFERASE/DNA COMPLEX
Deposited on 2002-06-12, released 2002-09-18
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.177
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: modification methylase hhai
    Species: Haemophilus haemolyticus [TaxId:726]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1m0ea_
  • Chain 'C':
    Compound: 5'-d(p*cp*cp*ap*tp*gp*cp*gp*cp*tp*gp*ap*c)-3'
  • Chain 'D':
    Compound: 5'-d(p*gp*tp*cp*ap*gp*(z)p*gp*cp*ap*tp*gp*g)-3'
  • Heterogens: SAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1m0eA (A:)
mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
qfgnsvvinvlqyiaynigsslnfkpy

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.