PDB entry 1m08

View 1m08 on RCSB PDB site
Description: Crystal structure of the unbound nuclease domain of ColE7
Class: Hydrolase
Keywords: HNH motif, endonuclease, colicin, Zn-binding protein, Hydrolase
Deposited on 2002-06-12, released 2002-12-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.187
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: colicin e7
    Species: ESCHERICHIA COLI [TaxId:316407]
    Gene: COLE7 or CEA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q47112 (1-130)
      • initiating met (0)
    Domains in SCOPe 2.08: d1m08a_
  • Chain 'B':
    Compound: colicin e7
    Species: ESCHERICHIA COLI [TaxId:316407]
    Gene: COLE7 or CEA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q47112 (1-130)
      • initiating met (0)
    Domains in SCOPe 2.08: d1m08b_
  • Heterogens: ZN, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m08A (A:)
    mrnkpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevsk
    dpelskqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhekpisqnggvydmdnisvvt
    pkrhidihrgk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m08B (B:)
    mrnkpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevsk
    dpelskqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhekpisqnggvydmdnisvvt
    pkrhidihrgk