PDB entry 1m07

View 1m07 on RCSB PDB site
Description: residues involved in the catalysis and base specificity of cytotoxic ribonuclease from bullfrog (rana catesbeiana)
Class: hydrolase/DNA
Keywords: RC-RNase-d(ACGA), ribonuclease, bullfrog, cytotoxicity, HYDROLASE/DNA COMPLEX
Deposited on 2002-06-12, released 2003-01-21
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.189
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ribonuclease
  Species: Rana catesbeiana [TaxId:8400]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P11916 (0-110)
    • modified residue (0)
  Domains in SCOPe 2.02: d1m07a_
• Chain 'B':
  Compound: Ribonuclease
  Species: Rana catesbeiana [TaxId:8400]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P11916 (0-110)
    • modified residue (0)
  Domains in SCOPe 2.02: d1m07b_
• Chain 'C':
  Compound: 5'-d(*ap*cp*gp*a)-3'
  
• Chain 'D':
  Compound: 5'-d(*ap*cp*gp*a)-3'
  
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1m07A (A:)
  enwatfqqkhiintpiincntimdnniyivggqckrvntfiissattvkaictgvinmnv
  lsttrfqlntctrtsitprpcpyssrtetnyicvkcenqypvhfagigrcp
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1m07B (B:)
  enwatfqqkhiintpiincntimdnniyivggqckrvntfiissattvkaictgvinmnv
  lsttrfqlntctrtsitprpcpyssrtetnyicvkcenqypvhfagigrcp
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.