PDB entry 1m07

View 1m07 on RCSB PDB site
Description: residues involved in the catalysis and base specificity of cytotoxic ribonuclease from bullfrog (rana catesbeiana)
Class: hydrolase/DNA
Keywords: RC-RNase-d(ACGA), ribonuclease, bullfrog, cytotoxicity, HYDROLASE-DNA COMPLEX
Deposited on 2002-06-12, released 2003-01-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease
    Species: Rana catesbeiana [TaxId:8400]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1m07a_
  • Chain 'B':
    Compound: Ribonuclease
    Species: Rana catesbeiana [TaxId:8400]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1m07b_
  • Chain 'C':
    Compound: 5'-d(*ap*cp*gp*a)-3'
  • Chain 'D':
    Compound: 5'-d(*ap*cp*gp*a)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m07A (A:)
    enwatfqqkhiintpiincntimdnniyivggqckrvntfiissattvkaictgvinmnv
    lsttrfqlntctrtsitprpcpyssrtetnyicvkcenqypvhfagigrcp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m07B (B:)
    enwatfqqkhiintpiincntimdnniyivggqckrvntfiissattvkaictgvinmnv
    lsttrfqlntctrtsitprpcpyssrtetnyicvkcenqypvhfagigrcp
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.