PDB entry 1m07
View 1m07 on RCSB PDB site
Description: residues involved in the catalysis and base specificity of cytotoxic ribonuclease from bullfrog (rana catesbeiana)
Class: hydrolase/DNA
Keywords: RC-RNase-d(ACGA), ribonuclease, bullfrog, cytotoxicity, HYDROLASE-DNA COMPLEX
Deposited on
2002-06-12, released
2003-01-21
The last revision prior to the SCOPe 2.08 freeze date was dated
2019-12-25, with a file datestamp of
2019-12-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Ribonuclease
Species: Rana catesbeiana [TaxId:8400]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1m07a_ - Chain 'B':
Compound: Ribonuclease
Species: Rana catesbeiana [TaxId:8400]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1m07b_ - Chain 'C':
Compound: 5'-d(*ap*cp*gp*a)-3'
- Chain 'D':
Compound: 5'-d(*ap*cp*gp*a)-3'
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1m07A (A:)
enwatfqqkhiintpiincntimdnniyivggqckrvntfiissattvkaictgvinmnv
lsttrfqlntctrtsitprpcpyssrtetnyicvkcenqypvhfagigrcp
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1m07B (B:)
enwatfqqkhiintpiincntimdnniyivggqckrvntfiissattvkaictgvinmnv
lsttrfqlntctrtsitprpcpyssrtetnyicvkcenqypvhfagigrcp
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.