PDB entry 1m06

View 1m06 on RCSB PDB site
Description: Structural Studies of Bacteriophage alpha3 Assembly, X-Ray Crystallography
Class: Virus/DNA
Keywords: Bacteriophage, three-dimensional structure, virion, morphogenesis, phiX174, assembly, microviridae, Icosahedral virus, Virus-DNA COMPLEX
Deposited on 2002-06-12, released 2002-12-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'F':
    Compound: capsid protein
    Species: Enterobacteria phage alpha3 [TaxId:10849]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08767 (Start-430)
      • see remark 999 (159)
    Domains in SCOPe 2.08: d1m06f_
  • Chain 'G':
    Compound: Major spike protein
    Species: Enterobacteria phage alpha3 [TaxId:10849]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1m06g_
  • Chain 'J':
    Compound: Small core protein
    Species: Enterobacteria phage alpha3 [TaxId:10849]
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: 5'-d(p*(3dr)p*(3dr)p*(3dr)p*(3dr)p*(3dr)p*(3dr)p*(3dr)p*(3dr)p*(3dr)p*(3dr))-3'
    Species: Enterobacteria phage alpha3 [TaxId:10849]

PDB Chain Sequences:

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1m06F (F:)
    msnvqtsaereivdlshlafdcgmlgrlktvswtpviagdsfeldavgalrlsplrrgla
    idskvdfftfyiphrhvygdqwiqfmrdgvnaqplpsvtcnrypdhagyvgtivpannri
    pkflhqsylniynnyfrapwmperteanpsnlneddarygfrcchlkniwsaplppetkl
    aeemgiesnsidimglqaayaqlhteqertyfmqryrdvissfggstsydadnrpllvmh
    tdfwasgydvdgtdqsslgqfsgrvqqtfkhsvprffvpehgvmmtlalirfppispleh
    hylagksqltytdlagdpalignlppreisyrdlfrdgrsgikikvaesiwyrthpdyvn
    fkyhdlhgfpflddapgtstgdnlqeailvrhqdydacfqsqqllqwnkqarynvsvyrh
    mptvrdsimts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m06F (F:)
    reivdlshlafdcgmlgrlktvswtpviagdsfeldavgalrlsplrrglaidskvdfft
    fyiphrhvygdqwiqfmrdgvnaqplpsvtcnrypdhagyvgtivpannripkflhqsyl
    niynnyfrapwmperteanpsnlneddarygfrcchlkniwsaplppetklaeemgiesn
    sidimglqaayaqlhteqertyfmqryrdvissfggstsydadnrpllvmhtdfwasgyd
    vdgtdqsslgqfsgrvqqtfkhsvprffvpehgvmmtlalirfppisplehhylagksql
    tytdlagdpalignlppreisyrdlfrdgrsgikikvaesiwyrthpdyvnfkyhdlhgf
    pflddapgtstgdnlqeailvrhqdydacfqsqqllqwnkqarynvsvyrhmptvrdsim
    ts
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m06G (G:)
    myqnfvtkhdtaiqtsrfsvtgnvipaaptgnipvinggsitaeravvnlyanmnvstss
    dgsfivamkvdtsptdpncvisagvnlsfagtsypivgivrfesaseqptsiagsevehy
    piemsvgsggvcsardcatvdihprtsgnnvfvgvicssakwtsgrvigtiattqvihey
    qvlqplk
    

  • Chain 'J':
    No sequence available.

  • Chain 'X':
    No sequence available.