PDB entry 1m04

View 1m04 on RCSB PDB site
Description: Mutant Streptomyces plicatus beta-hexosaminidase (D313N) in complex with product (GlcNAc)
Class: hydrolase
Keywords: substrate assisted catalysis, hexosaminidase, family 20 glycosidase, HYDROLASE
Deposited on 2002-06-11, released 2002-12-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.198
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-n-acetylhexosaminidase
    Species: Streptomyces plicatus [TaxId:1922]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O85361 (Start-511)
      • engineered (318)
    Domains in SCOPe 2.07: d1m04a1, d1m04a2
  • Heterogens: NAG, CL, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m04A (A:)
    mhhhhhhhtgaapdrkapvrptpldrvipapasvdpggapyritrgthirvddsrearrv
    gdyladllrpatgyrlpvtahghggirlrlaggpygdegyrldsgpagvtitarkaaglf
    hgvqtlrqllppavekdsaqpgpwlvaggtiedtpryawrsamldvsrhffgvdevkryi
    drvarykynklhlhlsddqgwriaidswprlatyggstevgggpggyytkaeykeivrya
    asrhlevvpeidmpghtnaalasyaelncdgvapplytgtkvgfsslcvdkdvtydfvdd
    vigelaaltpgrylhiggneahstpkadfvafmkrvqpivakygktvvgwhqlagaepve
    galvqywgldrtgdaekaevaeaarngtglilspadrtyldmkytkdtplglswagyvev
    qrsydwdpagylpgapadavrgveaplwtetlsdpdqldymafprlpgvaelgwspasth
    dwdtykvrlaaqapyweaagidfyrspqvpwt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m04A (A:)
    drkapvrptpldrvipapasvdpggapyritrgthirvddsrearrvgdyladllrpatg
    yrlpvtahghggirlrlaggpygdegyrldsgpagvtitarkaaglfhgvqtlrqllppa
    vekdsaqpgpwlvaggtiedtpryawrsamldvsrhffgvdevkryidrvarykynklhl
    hlsddqgwriaidswprlatyggstevgggpggyytkaeykeivryaasrhlevvpeidm
    pghtnaalasyaelncdgvapplytgtkvgfsslcvdkdvtydfvddvigelaaltpgry
    lhiggneahstpkadfvafmkrvqpivakygktvvgwhqlagaepvegalvqywgldrtg
    daekaevaeaarngtglilspadrtyldmkytkdtplglswagyvevqrsydwdpagylp
    gapadavrgveaplwtetlsdpdqldymafprlpgvaelgwspasthdwdtykvrlaaqa
    pyweaagidfyrspqvpwt