PDB entry 1lzo

View 1lzo on RCSB PDB site
Description: Plasmodium Falciparum Triosephosphate Isomerase-Phosphoglycolate Complex
Class: isomerase
Keywords: Triosephosphate Isomerase; Phosphoglycolate; Loop Dynamics; Loop Open Conformation
Deposited on 2002-06-11, released 2003-01-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.232
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: tpi
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07412 (Start-247)
      • conflict (162)
    Domains in SCOPe 2.07: d1lzoa_
  • Chain 'B':
    Compound: triosephosphate isomerase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: tpi
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07412 (Start-247)
      • conflict (162)
    Domains in SCOPe 2.07: d1lzob_
  • Chain 'C':
    Compound: triosephosphate isomerase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: tpi
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07412 (Start-247)
      • conflict (162)
    Domains in SCOPe 2.07: d1lzoc_
  • Chain 'D':
    Compound: triosephosphate isomerase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: tpi
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07412 (Start-247)
      • conflict (162)
    Domains in SCOPe 2.07: d1lzod_
  • Heterogens: PGA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lzoA (A:)
    markyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfs
    tgiqnvskfgngsytgevsaeiakdlnieyviighferrkyfhetdedvreklqaslknn
    lkavvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeq
    aqlvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesf
    vdiiksam
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lzoA (A:)
    rkyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfstg
    iqnvskfgngsytgevsaeiakdlnieyviighferrkyfhetdedvreklqaslknnlk
    avvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeqaq
    lvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesfvd
    iiksam
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lzoB (B:)
    markyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfs
    tgiqnvskfgngsytgevsaeiakdlnieyviighferrkyfhetdedvreklqaslknn
    lkavvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeq
    aqlvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesf
    vdiiksam
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lzoB (B:)
    rkyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfstg
    iqnvskfgngsytgevsaeiakdlnieyviighferrkyfhetdedvreklqaslknnlk
    avvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeqaq
    lvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesfvd
    iiksam
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1lzoC (C:)
    markyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfs
    tgiqnvskfgngsytgevsaeiakdlnieyviighferrkyfhetdedvreklqaslknn
    lkavvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeq
    aqlvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesf
    vdiiksam
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lzoC (C:)
    rkyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfstg
    iqnvskfgngsytgevsaeiakdlnieyviighferrkyfhetdedvreklqaslknnlk
    avvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeqaq
    lvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesfvd
    iiksam
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1lzoD (D:)
    markyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfs
    tgiqnvskfgngsytgevsaeiakdlnieyviighferrkyfhetdedvreklqaslknn
    lkavvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeq
    aqlvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesf
    vdiiksam
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lzoD (D:)
    rkyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfstg
    iqnvskfgngsytgevsaeiakdlnieyviighferrkyfhetdedvreklqaslknnlk
    avvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeqaq
    lvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesfvd
    iiksam