PDB entry 1lzg

View 1lzg on RCSB PDB site
Description:
Deposited on 1995-02-10, released 1995-05-08
The last revision prior to the SCOP 1.63 freeze date was dated 1995-05-08, with a file datestamp of 1995-05-09.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.159
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1lzg__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lzg_ (-)
    kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqins
    rfwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv
    qawirgcrl