PDB entry 1lze

View 1lze on RCSB PDB site
Description: dissection of protein-carbohydrate interactions in mutant hen egg-white lysozyme complexes and their hydrolytic activity
Class: hydrolase (o-glycosyl)
Keywords: hydrolase (o-glycosyl)
Deposited on 1995-02-10, released 1995-05-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.153
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hen egg white lysozyme
  Species: Gallus gallus [TaxId:9031]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00698 (0-128)
    • conflict (61)
  Domains in SCOPe 2.05: d1lzea_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1lzeA (A:)
  kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqins
  rywcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv
  qawirgcrl