PDB entry 1lz4

View 1lz4 on RCSB PDB site
Description: enthalpic destabilization of a mutant human lysozyme lacking a disulfide bridge between cysteine-77 and cysteine-95
Class: hydrolase(o-glycosyl)
Keywords: hydrolase(o-glycosyl)
Deposited on 1993-02-03, released 1993-10-31
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.188
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human lysozyme
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61626 (0-129)
      • conflict (76)
    Domains in SCOP 1.73: d1lz4a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lz4A (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnaahlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv