PDB entry 1lz2

View 1lz2 on RCSB PDB site
Description: crystallographic study of turkey egg-white lysozyme and its complex with a disaccharide
Class: hydrolase (o-glycosyl)
Keywords: hydrolase (o-glycosyl)
Deposited on 1981-09-21, released 1981-12-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: turkey egg white lysozyme
    Species: Meleagris gallopavo [TaxId:9103]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00703 (0-128)
      • conflict (47)
      • conflict (64-65)
      • conflict (72)
      • conflict (102)
    Domains in SCOPe 2.04: d1lz2a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lz2A (A:)
    kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntngstdygilqins
    rwwcdngrtpgsrnlcnipcsallssditasvncakkiasggdgmnawvawrnrckgtdv
    hawirgcrl