PDB entry 1lyy

View 1lyy on RCSB PDB site
Description: amyloidogenic variant (asp67his) of human lysozyme
Class: hydrolase
Keywords: hydrolase, enzyme, beta-1,4-glycan-hydrolase
Deposited on 1997-01-16, released 1997-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.228
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61626 (0-129)
      • engineered (66)
    Domains in SCOPe 2.07: d1lyya_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lyyA (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcnhgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv