PDB entry 1lyx

View 1lyx on RCSB PDB site
Description: Plasmodium Falciparum Triosephosphate Isomerase (PfTIM)-Phosphoglycolate complex
Deposited on 2002-06-10, released 2003-01-28
The last revision prior to the SCOP 1.69 freeze date was dated 2003-01-28, with a file datestamp of 2003-01-28.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.18
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1lyxa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lyxA (A:)
    markyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfs
    tgiqnvskfgngsytgevsaeiakdlnieyviighferrkyfhetdedvreklqaslknn
    lkavvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeq
    aqlvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesf
    vdiiksam
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lyxA (A:)
    rkyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfstg
    iqnvskfgngsytgevsaeiakdlnieyviighferrkyfhetdedvreklqaslknnlk
    avvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeqaq
    lvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesfvd
    iiksam