PDB entry 1lyw

View 1lyw on RCSB PDB site
Description: cathepsin d at ph 7.5
Class: aspartic protease
Keywords: aspartic protease, hydrolase, glycoprotein
Deposited on 1998-06-30, released 1999-07-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.195
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cathepsin d
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1lyw.1
  • Chain 'B':
    Compound: cathepsin d
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1lyw.1
  • Chain 'C':
    Compound: cathepsin d
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1lyw.2
  • Chain 'D':
    Compound: cathepsin d
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1lyw.2
  • Chain 'E':
    Compound: cathepsin d
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1lyw.3
  • Chain 'F':
    Compound: cathepsin d
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1lyw.3
  • Chain 'G':
    Compound: cathepsin d
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1lyw.4
  • Chain 'H':
    Compound: cathepsin d
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1lyw.4
  • Heterogens: EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lywA (A:)
    gpipevlknymdaqyygeigigtppqcftvvfdtgssnlwvpsihcklldiacwihhkyn
    sdksstyvkngtsfdihygsgslsgylsqdtvsvpcq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lywA (A:)
    ipevlknymdaqyygeigigtppqcftvvfdtgssnlwvpsihcklldiacwihhkynsd
    ksstyvkngtsfdihygsgslsgylsqdtvsvpcq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lywB (B:)
    ggvkverqvfgeatkqpgitfiaakfdgilgmayprisvnnvlpvfdnlmqqklvdqnif
    sfylsrdpdaqpggelmlggtdskyykgslsylnvtrkaywqvhldqvevasgltlckeg
    ceaivdtgtslmvgpvdevrelqkaigavpliqgeymipcekvstlpaitlklggkgykl
    spedytlkvsqagktlclsgfmgmdipppsgplwilgdvfigryytvfdrdnnrvgfaea
    a
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1lywC (C:)
    gpipevlknymdaqyygeigigtppqcftvvfdtgssnlwvpsihcklldiacwihhkyn
    sdksstyvkngtsfdihygsgslsgylsqdtvsvpcq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lywC (C:)
    ipevlknymdaqyygeigigtppqcftvvfdtgssnlwvpsihcklldiacwihhkynsd
    ksstyvkngtsfdihygsgslsgylsqdtvsvpcq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lywD (D:)
    ggvkverqvfgeatkqpgitfiaakfdgilgmayprisvnnvlpvfdnlmqqklvdqnif
    sfylsrdpdaqpggelmlggtdskyykgslsylnvtrkaywqvhldqvevasgltlckeg
    ceaivdtgtslmvgpvdevrelqkaigavpliqgeymipcekvstlpaitlklggkgykl
    spedytlkvsqagktlclsgfmgmdipppsgplwilgdvfigryytvfdrdnnrvgfaea
    a
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1lywE (E:)
    gpipevlknymdaqyygeigigtppqcftvvfdtgssnlwvpsihcklldiacwihhkyn
    sdksstyvkngtsfdihygsgslsgylsqdtvsvpcq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lywE (E:)
    ipevlknymdaqyygeigigtppqcftvvfdtgssnlwvpsihcklldiacwihhkynsd
    ksstyvkngtsfdihygsgslsgylsqdtvsvpcq
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lywF (F:)
    ggvkverqvfgeatkqpgitfiaakfdgilgmayprisvnnvlpvfdnlmqqklvdqnif
    sfylsrdpdaqpggelmlggtdskyykgslsylnvtrkaywqvhldqvevasgltlckeg
    ceaivdtgtslmvgpvdevrelqkaigavpliqgeymipcekvstlpaitlklggkgykl
    spedytlkvsqagktlclsgfmgmdipppsgplwilgdvfigryytvfdrdnnrvgfaea
    a
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1lywG (G:)
    gpipevlknymdaqyygeigigtppqcftvvfdtgssnlwvpsihcklldiacwihhkyn
    sdksstyvkngtsfdihygsgslsgylsqdtvsvpcq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lywG (G:)
    ipevlknymdaqyygeigigtppqcftvvfdtgssnlwvpsihcklldiacwihhkynsd
    ksstyvkngtsfdihygsgslsgylsqdtvsvpcq
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lywH (H:)
    ggvkverqvfgeatkqpgitfiaakfdgilgmayprisvnnvlpvfdnlmqqklvdqnif
    sfylsrdpdaqpggelmlggtdskyykgslsylnvtrkaywqvhldqvevasgltlckeg
    ceaivdtgtslmvgpvdevrelqkaigavpliqgeymipcekvstlpaitlklggkgykl
    spedytlkvsqagktlclsgfmgmdipppsgplwilgdvfigryytvfdrdnnrvgfaea
    a