PDB entry 1lyv

View 1lyv on RCSB PDB site
Description: high-resolution structure of the catalytically inactive yersinia tyrosine phosphatase c403a mutant in complex with phosphate.
Deposited on 2002-06-08, released 2002-07-03
The last revision prior to the SCOP 1.69 freeze date was dated 2002-07-03, with a file datestamp of 2002-07-03.
Experiment type: XRAY
Resolution: 1.36 Å
R-factor: 0.137
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1lyva_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lyvA (A:)
    mrerphtsghhgagearatapstvspygpearaelssrlttlrntlapatndprylqacg
    geklnrfrdiqcrrqtavradlnanyiqvgntrtiacqyplqsqleshfrmlaenrtpvl
    avlassseianqrfgmpdyfrqsgtygsitveskmtqqvglgdgimadmytltireagqk
    tisvpvvhvgnwpdqtavssevtkalaslvdqtaetkrnmyeskgssavaddsklrpvih
    sragvgrtaqligamcmndsrnsqlsvedmvsqmrvqrngimvqkdeqldvliklaegqg
    rpllns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lyvA (A:)
    vspygpearaelssrlttlrntlapatndprylqacggeklnrfrdiqcrrqtavradln
    anyiqvgntrtiacqyplqsqleshfrmlaenrtpvlavlassseianqrfgmpdyfrqs
    gtygsitveskmtqqvglgdgimadmytltireagqktisvpvvhvgnwpdqtavssevt
    kalaslvdqtaetkrnmyeskgssavaddsklrpvihsragvgrtaqligamcmndsrns
    qlsvedmvsqmrvqrngimvqkdeqldvliklaegqgrpllns