PDB entry 1lyn

View 1lyn on RCSB PDB site
Description: crystal structure and subunit dynamics of the lysin dimer: egg envelopes dissociate dimers, the monomer is the active species
Class: fertilization protein
Keywords: fertilization protein
Deposited on 1995-03-03, released 1995-06-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.233
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sperm lysin
    Species: Haliotis rufescens [TaxId:6454]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lyna_
  • Chain 'B':
    Compound: sperm lysin
    Species: Haliotis rufescens [TaxId:6454]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lynb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lynA (A:)
    rswhyvepkflnkafevalkvqiiagfdrglvkwlrvhgrtlstvqkkalyfvnrrymqt
    hwanymlwinkkidalgrtpvvgdytrlgaeigrridmayfydflkdknmipkylpymee
    inrmrpadvpvkymgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lynA (A:)
    flnkafevalkvqiiagfdrglvkwlrvhgrtlstvqkkalyfvnrrymqthwanymlwi
    nkkidalgrtpvvgdytrlgaeigrridmayfydflkdknmipkylpymeeinrmrpadv
    pvkym
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lynB (B:)
    rswhyvepkflnkafevalkvqiiagfdrglvkwlrvhgrtlstvqkkalyfvnrrymqt
    hwanymlwinkkidalgrtpvvgdytrlgaeigrridmayfydflkdknmipkylpymee
    inrmrpadvpvkymgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lynB (B:)
    flnkafevalkvqiiagfdrglvkwlrvhgrtlstvqkkalyfvnrrymqthwanymlwi
    nkkidalgrtpvvgdytrlgaeigrridmayfydflkdknmipkylpymeeinrmrpadv
    pvkym