PDB entry 1lyd

View 1lyd on RCSB PDB site
Description: crystal structure of t4-lysozyme generated from synthetic coding dna expressed in escherichia coli
Deposited on 1989-01-11, released 1990-04-15
The last revision prior to the SCOP 1.71 freeze date was dated 1990-10-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2 Å
R-factor: 0.191
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1lyd__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1lyd_ (-)
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrrcalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl