PDB entry 1lyb

View 1lyb on RCSB PDB site
Description: crystal structures of native and inhibited forms of human cathepsin d: implications for lysosomal targeting and drug design
Class: hydrolase/hydrolase inhibitor
Keywords: lysosomal aspartic protease, hydrolase-hydrolase inhibitor complex
Deposited on 1993-04-22, released 1994-01-31
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.179
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cathepsin d
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1lyb.1
  • Chain 'B':
    Compound: cathepsin d
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1lyb.1
  • Chain 'C':
    Compound: cathepsin d
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1lyb.2
  • Chain 'D':
    Compound: cathepsin d
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1lyb.2
  • Chain 'I':
    Compound: pepstatin
    Species:
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1LYB (0-5)
  • Chain 'J':
    Compound: pepstatin
    Species:
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1LYB (0-5)
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lybA (A:)
    gpipevlknymdaqyygeigigtppqcftvvfdtgssnlwvpsihcklldiacwihhkyn
    sdksstyvkngtsfdihygsgslsgylsqdtvsvpcq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lybB (B:)
    ggvkverqvfgeatkqpgitfiaakfdgilgmayprisvnnvlpvfdnlmqqklvdqnif
    sfylsrdpdaqpggelmlggtdskyykgslsylnvtrkaywqvhldqvevasgltlckeg
    ceaivdtgtslmvgpvdevrelqkaigavpliqgeymipcekvstlpaitlklggkgykl
    spedytlkvsqagktlclsgfmgmdipppsgplwilgdvfigryytvfdrdnnrvgfaea
    a
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lybC (C:)
    gpipevlknymdaqyygeigigtppqcftvvfdtgssnlwvpsihcklldiacwihhkyn
    sdksstyvkngtsfdihygsgslsgylsqdtvsvpcq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lybD (D:)
    ggvkverqvfgeatkqpgitfiaakfdgilgmayprisvnnvlpvfdnlmqqklvdqnif
    sfylsrdpdaqpggelmlggtdskyykgslsylnvtrkaywqvhldqvevasgltlckeg
    ceaivdtgtslmvgpvdevrelqkaigavpliqgeymipcekvstlpaitlklggkgykl
    spedytlkvsqagktlclsgfmgmdipppsgplwilgdvfigryytvfdrdnnrvgfaea
    a
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.