PDB entry 1ly4

View 1ly4 on RCSB PDB site
Description: Analysis of quinazoline and PYRIDO[2,3D]PYRIMIDINE N9-C10 reversed bridge antifolates in complex with NADP+ and Pneumocystis carinii dihydrofolate reductase
Class: oxidoreductase
Keywords: pcDHFR, N9-C10 reversed bridge pyridopyrimidine antifolate
Deposited on 2002-06-06, released 2002-08-28
The last revision prior to the SCOP 1.75 freeze date was dated 2005-04-12, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.193
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Pneumocystis carinii
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ly4a_
  • Heterogens: NAP, COQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ly4A (A:)
    mnqqksltlivalttsygigrsnslpwklkkeisyfkrvtsfvptfdsfesmnvvlmgrk
    twesiplqfrplkgrinvvitrnesldlgngihsaksldhalellyrtygsessvqinri
    fviggaqlykaamdhpkldrimatiiykdihcdvffplkfrdkewssvwkkekhsdlesw
    vgtkvphgkinedgfdyefemwtrdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ly4A (A:)
    nqqksltlivalttsygigrsnslpwklkkeisyfkrvtsfvptfdsfesmnvvlmgrkt
    wesiplqfrplkgrinvvitrnesldlgngihsaksldhalellyrtygsessvqinrif
    viggaqlykaamdhpkldrimatiiykdihcdvffplkfrdkewssvwkkekhsdleswv
    gtkvphgkinedgfdyefemwtrdl