PDB entry 1ly2

View 1ly2 on RCSB PDB site
Description: crystal structure of unliganded human cd21 scr1-scr2 (complement receptor type 2)
Deposited on 2002-06-06, released 2002-07-05
The last revision prior to the SCOP 1.67 freeze date was dated 2002-08-23, with a file datestamp of 2002-08-23.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.179
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ly2A (A:)
    eascgspppilngrisyystpiavgtviryscsgtfrligeksllcitkdkvdgtwdkpa
    pkceyfnkysscpepivpggykirgstpyrhgdsvtfacktnfsmngnksvwcqannmwg
    ptrlptcvsi