PDB entry 1ly2

View 1ly2 on RCSB PDB site
Description: Crystal structure of unliganded human CD21 SCR1-SCR2 (Complement receptor type 2)
Class: immune system
Keywords: Complement receptor; Epstein Barr virus; Regulator of complement activation; short consensus repeat; viral receptor; complement control protein, IMMUNE SYSTEM
Deposited on 2002-06-06, released 2002-07-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: complement receptor type 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CR2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20023 (0-129)
      • cloning artifact (0-1)
      • cloning artifact (129)
    Domains in SCOPe 2.08: d1ly2a1, d1ly2a2, d1ly2a3, d1ly2a4
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ly2A (A:)
    eascgspppilngrisyystpiavgtviryscsgtfrligeksllcitkdkvdgtwdkpa
    pkceyfnkysscpepivpggykirgstpyrhgdsvtfacktnfsmngnksvwcqannmwg
    ptrlptcvsi