PDB entry 1ly1

View 1ly1 on RCSB PDB site
Description: Structure and Mechanism of T4 Polynucleotide Kinase
Class: transferase
Keywords: pnk, kinase, phosphatase, polynucleotide, t4, phage, transferase
Deposited on 2002-06-06, released 2002-07-17
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.21
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polynucleotide kinase
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: pseT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1ly1a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ly1A (A:)
    mkkiiltigcpgsgkstwarefiaknpgfyninrddyrqsimaheerdeykytkkkegiv
    tgmqfdtaksilyggdsvkgviisdtnlnperrlawetfakeygwkvehkvfdvpwtelv
    krnskrgtkavpidvlrsmyksmreylglpvyngtpgkpkavifdvdgtlakmngrgpyd
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ly1A (A:)
    mkkiiltigcpgsgkstwarefiaknpgfyninrddyrqsimaheerdeykytkkkegiv
    tgmqfdtaksilyggdsvkgviisdtnlnperrlawetfakeygwkvehkvfdvpwtelv
    krnskrgtkavpidvlrsmyksmreylglpvy