PDB entry 1ly1

View 1ly1 on RCSB PDB site
Description: Structure and Mechanism of T4 Polynucleotide Kinase
Deposited on 2002-06-06, released 2002-07-17
The last revision prior to the SCOP 1.63 freeze date was dated 2002-07-17, with a file datestamp of 2002-07-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.21
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1ly1a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ly1A (A:)
    mkkiiltigcpgsgkstwarefiaknpgfyninrddyrqsimaheerdeykytkkkegiv
    tgmqfdtaksilyggdsvkgviisdtnlnperrlawetfakeygwkvehkvfdvpwtelv
    krnskrgtkavpidvlrsmyksmreylglpvy