PDB entry 1lxy

View 1lxy on RCSB PDB site
Description: Crystal Structure of Arginine Deiminase covalently linked with L-citrulline
Deposited on 2002-06-06, released 2004-01-20
The last revision prior to the SCOP 1.69 freeze date was dated 2004-04-13, with a file datestamp of 2004-04-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.186
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1lxya_
  • Chain 'B':
    Domains in SCOP 1.69: d1lxyb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lxyA (A:)
    svfdskfkgihvyseigelesvlvhepgreidyitparldellfsaileshdarkehkqf
    vaelkandinvvelidlvaetydlasqeakdklieefledsepvlseehkvvvrnflkak
    ktsrelveimmagitkydlgieadhelivdpmpnlyftrdpfasvgngvtihymrykvrq
    retlfsrfvfsnhpklintpwyydpslklsieggdvfiynndtlvvgvsertdlqtvtll
    aknivankecefkrivainvpkwtnlmhldtwltmldkdkflyspiandvfkfwdydlvn
    ggaepqpvenglplegllqsiinkkpvlipiagegasqmeierethfdgtnylairpgvv
    igysrnektnaaleaagikvlpfhgnqlslgmgnarcmsmplsrkdvkw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lxyB (B:)
    svfdskfkgihvyseigelesvlvhepgreidyitparldellfsaileshdarkehkqf
    vaelkandinvvelidlvaetydlasqeakdklieefledsepvlseehkvvvrnflkak
    ktsrelveimmagitkydlgieadhelivdpmpnlyftrdpfasvgngvtihymrykvrq
    retlfsrfvfsnhpklintpwyydpslklsieggdvfiynndtlvvgvsertdlqtvtll
    aknivankecefkrivainvpkwtnlmhldtwltmldkdkflyspiandvfkfwdydlvn
    ggaepqpvenglplegllqsiinkkpvlipiagegasqmeierethfdgtnylairpgvv
    igysrnektnaaleaagikvlpfhgnqlslgmgnarcmsmplsrkdvkw