PDB entry 1lxt

View 1lxt on RCSB PDB site
Description: structure of phosphotransferase phosphoglucomutase from rabbit
Class: phosphotransferase
Keywords: phosphoglucomutase, dephosphoform, phosphotransferase
Deposited on 1996-07-28, released 1997-02-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.201
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoglucomutase (dephospho form)
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lxta1, d1lxta2, d1lxta3, d1lxta4
  • Chain 'B':
    Compound: phosphoglucomutase (dephospho form)
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lxtb1, d1lxtb2, d1lxtb3, d1lxtb4
  • Heterogens: CD, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lxtA (A:)
    vkivtvktkaypdqkpgtsglrkrvkvfqsstnyaenfiqsiistvepaqrqeatlvvgg
    dgrfymkeaiqlivriaaangigrlvigqngilstpavsciirkikaiggiiltashnpg
    gpngdfgikfnisnggpapeaitdkifqisktieeyaicpdlkvdlgvlgkqqfdlenkf
    kpftveivdsveayatmlrnifdfnalkellsgpnrlkiridamhgvvgpyvkkilceel
    gapansavncvpledfgghhpdpnltyaadlvetmksgehdfgaafdgdgdrnmilgkhg
    ffvnpsdsvaviaanifsipyfqqtgvrgfarsmptsgaldrvanatkialyetptgwkf
    fgnlmdasklslcgeesfgtgsdhirekdglwavlawlsilatrkqsvedilkdhwhkfg
    rnfftrydyeeveaegatkmmkdlealmfdrsfvgkqfsandkvytvekadnfeyhdpvd
    gsvsknqglrlifadgsriifrlsgtgsagatirlyidsyekdnakinqdpqvmlaplis
    ialkvsqlqertgrtaptvit
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lxtB (B:)
    vkivtvktkaypdqkpgtsglrkrvkvfqsstnyaenfiqsiistvepaqrqeatlvvgg
    dgrfymkeaiqlivriaaangigrlvigqngilstpavsciirkikaiggiiltashnpg
    gpngdfgikfnisnggpapeaitdkifqisktieeyaicpdlkvdlgvlgkqqfdlenkf
    kpftveivdsveayatmlrnifdfnalkellsgpnrlkiridamhgvvgpyvkkilceel
    gapansavncvpledfgghhpdpnltyaadlvetmksgehdfgaafdgdgdrnmilgkhg
    ffvnpsdsvaviaanifsipyfqqtgvrgfarsmptsgaldrvanatkialyetptgwkf
    fgnlmdasklslcgeesfgtgsdhirekdglwavlawlsilatrkqsvedilkdhwhkfg
    rnfftrydyeeveaegatkmmkdlealmfdrsfvgkqfsandkvytvekadnfeyhdpvd
    gsvsknqglrlifadgsriifrlsgtgsagatirlyidsyekdnakinqdpqvmlaplis
    ialkvsqlqertgrtaptvit