PDB entry 1lxn

View 1lxn on RCSB PDB site
Description: x-ray structure of mth1187 northeast structural genomics consortium target tt272
Class: structural genomics, unknown function
Keywords: HYPOTHETICAL STRUCTURE, STRUCTURAL GENOMICS, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2002-06-05, released 2003-07-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.216
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein mth1187
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O27255
      • modified residue (0)
      • modified residue (40)
      • modified residue (53)
    Domains in SCOPe 2.08: d1lxna_
  • Chain 'B':
    Compound: hypothetical protein mth1187
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O27255
      • modified residue (0)
      • modified residue (40)
      • modified residue (53)
    Domains in SCOPe 2.08: d1lxnb_
  • Chain 'C':
    Compound: hypothetical protein mth1187
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O27255
      • modified residue (0)
      • modified residue (40)
      • modified residue (53)
    Domains in SCOPe 2.08: d1lxnc_
  • Chain 'D':
    Compound: hypothetical protein mth1187
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O27255 (0-98)
      • modified residue (0)
      • modified residue (40)
      • modified residue (53)
    Domains in SCOPe 2.08: d1lxnd_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1lxnA (A:)
mitaeltviplgtcstslssyvaaavealkklnvryeisgmgtlleaedldelmeavkaa
heavlqagsdrvyttlkiddrrdadrglrdkvesvkeki

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1lxnB (B:)
mitaeltviplgtcstslssyvaaavealkklnvryeisgmgtlleaedldelmeavkaa
heavlqagsdrvyttlkiddrrdadrglrdkvesvkeki

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1lxnC (C:)
mitaeltviplgtcstslssyvaaavealkklnvryeisgmgtlleaedldelmeavkaa
heavlqagsdrvyttlkiddrrdadrglrdkvesvkeki

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1lxnD (D:)
mitaeltviplgtcstslssyvaaavealkklnvryeisgmgtlleaedldelmeavkaa
heavlqagsdrvyttlkiddrrdadrglrdkvesvkeki