PDB entry 1lxm

View 1lxm on RCSB PDB site
Description: Crystal Structure of Streptococcus agalactiae Hyaluronate Lyase Complexed with Hexasaccharide Unit of Hyaluronan
Class: lyase
Keywords: Streptococcus agalactiae, Protein-carbohydrate complex, hyaluronan, LYASE
Deposited on 2002-06-05, released 2002-10-30
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.218
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hyaluronate lyase
    Species: STREPTOCOCCUS AGALACTIAE [TaxId:1311]
    Gene: HYL
    Database cross-references and differences (RAF-indexed):
    • Uniprot q53591 (Start-813)
      • see remark 999 (75)
      • see remark 999 (77)
      • see remark 999 (109)
      • see remark 999 (117)
      • see remark 999 (412)
      • see remark 999 (517-518)
      • see remark 999 (711)
      • see remark 999 (723)
    Domains in SCOPe 2.04: d1lxma1, d1lxma2, d1lxma3, d1lxma4
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lxmA (A:)
    sehpqpvttqieksvntalnknyvfnkadyqytltnpslgkivggilypnatgsttvkis
    dksgkiikevplsvtastednftklldkwndvtignyvydtndsnmqklnqkldetnakn
    ieaikldsnrtflwkdldnlnnsaqltatyrrledlakqitnphstiyknekairtvkes
    lawlhqnfynvnkdiegsanwwdfeigvprsitgtlslmnnyftdaeiktytdpiehfvp
    daeyfrktlvnpfkalggnlvdmgrvkiiegllrkdntiiektshslknlfttatkaegf
    yadgsyidhtnvaytgaygnvlidgltqllpiiqetdykisnqeldmvykwinqsflpli
    vkgelmdmsrgrsisreaasshaaavevlrgflrlanmsneernldlkstiktiitsnkf
    ynvfnnlksysdianmnkllndstvatkplksnlstfnsmdrlayynakkdfgfalslhs
    krtlnyegmndentrgwytgdgmfyiynsdqshysnhfwptvnpykmagttekdakredt
    tkefmskhskdakektgqvtgtsdfvgsvklndhfalaamdftnwdrtltaqkgwvilnd
    kivflgsnikntngignvsttidqrkddsktpyttyvngktidlkqassqqftdtksvfl
    eskepgrnigyiffknstidierkeqtgtwnsinrtskntsivsnpfitisqkhdnkgds
    ygymmvpnidrtsfdklanskevellensskqqviydknsqtwavikhdnqeslinnqfk
    mnkaglylvqkvgndyqnvyyqpqtmtktdqlai
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lxmA (A:)
    hpqpvttqieksvntalnknyvfnkadyqytltnpslgkivggilypnatgsttvkisdk
    sgkiikevplsvtastednftklldkwndvtignyvydtndsnmqklnqkldetnaknie
    aikldsnrtflwkdldnlnnsaqltatyrrledlakqitnphstiyknekairtvkesla
    wlhqnfynvnkdiegsanwwdfeigvprsitgtlslmnnyftdaeiktytdpiehfvpda
    eyfrktlvnpfkalggnlvdmgrvkiiegllrkdntiiektshslknlfttatkaegfya
    dgsyidhtnvaytgaygnvlidgltqllpiiqetdykisnqeldmvykwinqsflplivk
    gelmdmsrgrsisreaasshaaavevlrgflrlanmsneernldlkstiktiitsnkfyn
    vfnnlksysdianmnkllndstvatkplksnlstfnsmdrlayynakkdfgfalslhskr
    tlnyegmndentrgwytgdgmfyiynsdqshysnhfwptvnpykmagttekdakredttk
    eakektgqvtgtsdfvgsvklndhfalaamdftnwdrtltaqkgwvilndkivflgsnik
    ntngignvsttidqrkddsktpyttyvngktisqqftdtksvfleskepgrnigyiffkn
    stidierkeqtgtwnsinrtskntsivsnpfitisqkhdsygymmvpnidrtsfdklans
    kevellensskqqviydknsqtwavikhdnqeslinnqfkmnkaglylvqkvgndyqnvy
    yqpqtmtktdqlai