PDB entry 1lxm

View 1lxm on RCSB PDB site
Description: crystal structure of streptococcus agalactiae hyaluronate lyase complexed with hexasaccharide unit of hyaluronan
Deposited on 2002-06-05, released 2002-10-30
The last revision prior to the SCOP 1.63 freeze date was dated 2002-10-30, with a file datestamp of 2002-10-30.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.218
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lxmA (A:)
    hpqpvttqieksvntalnknyvfnkadyqytltnpslgkivggilypnatgsttvkisdk
    sgkiikevplsvtastednftklldkwndvtignyvydtndsnmqklnqkldetnaknie
    aikldsnrtflwkdldnlnnsaqltatyrrledlakqitnphstiyknekairtvkesla
    wlhqnfynvnkdiegsanwwdfeigvprsitgtlslmnnyftdaeiktytdpiehfvpda
    eyfrktlvnpfkalggnlvdmgrvkiiegllrkdntiiektshslknlfttatkaegfya
    dgsyidhtnvaytgaygnvlidgltqllpiiqetdykisnqeldmvykwinqsflplivk
    gelmdmsrgrsisreaasshaaavevlrgflrlanmsneernldlkstiktiitsnkfyn
    vfnnlksysdianmnkllndstvatkplksnlstfnsmdrlayynakkdfgfalslhskr
    tlnyegmndentrgwytgdgmfyiynsdqshysnhfwptvnpykmagttekdakredttk
    efmskhskdakektgqvtgtsdfvgsvklndhfalaamdftnwdrtltaqkgwvilndki
    vflgsnikntngignvsttidqrkddsktpyttyvngktidlkqassqqftdtksvfles
    kepgrnigyiffknstidierkeqtgtwnsinrtskntsivsnpfitisqkhdnkgdsyg
    ymmvpnidrtsfdklanskevellensskqqviydknsqtwavikhdnqeslinnqfkmn
    kaglylvqkvgndyqnvyyqpqtmtktdqlai
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lxmA (A:)
    hpqpvttqieksvntalnknyvfnkadyqytltnpslgkivggilypnatgsttvkisdk
    sgkiikevplsvtastednftklldkwndvtignyvydtndsnmqklnqkldetnaknie
    aikldsnrtflwkdldnlnnsaqltatyrrledlakqitnphstiyknekairtvkesla
    wlhqnfynvnkdiegsanwwdfeigvprsitgtlslmnnyftdaeiktytdpiehfvpda
    eyfrktlvnpfkalggnlvdmgrvkiiegllrkdntiiektshslknlfttatkaegfya
    dgsyidhtnvaytgaygnvlidgltqllpiiqetdykisnqeldmvykwinqsflplivk
    gelmdmsrgrsisreaasshaaavevlrgflrlanmsneernldlkstiktiitsnkfyn
    vfnnlksysdianmnkllndstvatkplksnlstfnsmdrlayynakkdfgfalslhskr
    tlnyegmndentrgwytgdgmfyiynsdqshysnhfwptvnpykmagttekdakredttk
    eakektgqvtgtsdfvgsvklndhfalaamdftnwdrtltaqkgwvilndkivflgsnik
    ntngignvsttidqrkddsktpyttyvngktisqqftdtksvfleskepgrnigyiffkn
    stidierkeqtgtwnsinrtskntsivsnpfitisqkhdsygymmvpnidrtsfdklans
    kevellensskqqviydknsqtwavikhdnqeslinnqfkmnkaglylvqkvgndyqnvy
    yqpqtmtktdqlai