PDB entry 1lxi

View 1lxi on RCSB PDB site
Description: Refinement of BMP7 crystal structure
Class: hormone/growth factor
Keywords: Cystine-knot growth factor, HORMONE-GROWTH FACTOR COMPLEX
Deposited on 2002-06-05, released 2003-04-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bone morphogenetic protein 7
    Species: Homo sapiens [TaxId:9606]
    Gene: BMP7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1lxia_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lxiA (A:)
    stgskqrsqnrsktpknqealrmanvaensssdqrqackkhelyvsfrdlgwqdwiiape
    gyaayycegecafplnsymnatnhaivqtlvhfinpetvpkpccaptqlnaisvlyfdds
    snvilkkyrnmvvracgch
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lxiA (A:)
    qackkhelyvsfrdlgwqdwiiapegyaayycegecafplnsymnatnhaivqtlvhfin
    petvpkpccaptqlnaisvlyfddssnvilkkyrnmvvracgch