PDB entry 1lxf

View 1lxf on RCSB PDB site
Description: Structure of the Regulatory N-domain of Human Cardiac Troponin C in Complex with Human Cardiac Troponin-I(147-163) and Bepridil
Class: metal binding protein, protein binding
Keywords: muscle, cardiac troponin C-drug interaction, bepridil, cardiac troponin I-drug interaction
Deposited on 2002-06-05, released 2002-12-11
The last revision prior to the SCOP 1.73 freeze date was dated 2002-12-11, with a file datestamp of 2007-06-04.
Experiment type: NMR30
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'C':
  Compound: troponin c, slow skeletal and cardiac muscles
  Species: HOMO SAPIENS
  Gene: TNNC
  Database cross-references and differences (RAF-indexed):
  • Uniprot P63316 (0-88)
  Domains in SCOP 1.73: d1lxfc_
• Chain 'I':
  Compound: Troponin I, cardiac muscle
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P19429 (0-16)
  Domains in SCOP 1.73: d1lxfi_
• Heterogens: CA, BEP

PDB Chain Sequences:

• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1lxfC (C:)
  mddiykaaveqlteeqknefkaafdifvlgaedgcistkelgkvmrmlgqnptpeelqem
  idevdedgsgtvdfdeflvmmvrcmkdds
  

  
  
• Chain 'I':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1lxfI (I:)
  risadammqallgarak