PDB entry 1lxf

View 1lxf on RCSB PDB site
Description: structure of the regulatory n-domain of human cardiac troponin c in complex with human cardiac troponin-i(147-163) and bepridil
Deposited on 2002-06-05, released 2002-12-11
The last revision prior to the SCOP 1.71 freeze date was dated 2002-12-11, with a file datestamp of 2002-12-11.
Experiment type: NMR30
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Domains in SCOP 1.71: d1lxfc_
  • Chain 'I':
    Domains in SCOP 1.71: d1lxfi_

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1lxfC (C:)
mddiykaaveqlteeqknefkaafdifvlgaedgcistkelgkvmrmlgqnptpeelqem
idevdedgsgtvdfdeflvmmvrcmkdds

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1lxfI (I:)
risadammqallgarak