PDB entry 1lxf

View 1lxf on RCSB PDB site
Description: Structure of the Regulatory N-domain of Human Cardiac Troponin C in Complex with Human Cardiac Troponin-I(147-163) and Bepridil
Class: metal binding protein, protein binding
Keywords: muscle, cardiac troponin C-drug interaction, bepridil, cardiac troponin I-drug interaction, METAL BINDING PROTEIN, PROTEIN BINDING
Deposited on 2002-06-05, released 2002-12-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: troponin c, slow skeletal and cardiac muscles
    Species: Homo sapiens [TaxId:9606]
    Gene: TNNC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1lxfc_
  • Chain 'I':
    Compound: Troponin I, cardiac muscle
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1lxfi_
  • Heterogens: CA, BEP

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lxfC (C:)
    mddiykaaveqlteeqknefkaafdifvlgaedgcistkelgkvmrmlgqnptpeelqem
    idevdedgsgtvdfdeflvmmvrcmkdds
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lxfI (I:)
    risadammqallgarak