PDB entry 1lxa

View 1lxa on RCSB PDB site
Description: udp n-acetylglucosamine acyltransferase
Deposited on 1995-10-07, released 1995-12-07
The last revision prior to the SCOP 1.71 freeze date was dated 1995-12-07, with a file datestamp of 1995-12-07.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.184
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1lxa__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lxa_ (-)
    midksafvhptaiveegasiganahigpfcivgphveigegtvlkshvvvnghtkigrdn
    eiyqfasigevnqdlkyageptrveigdrnriresvtihrgtvqgggltkvgsdnllmin
    ahiahdctvgnrcilannatlaghvsvddfaiiggmtavhqfciigahvmvggcsgvaqd
    vppyviaqgnhatpfgvnieglkrrgfsreaitairnaykliyrsgktldevkpeiaela
    etypevkaftdffarstrglir