PDB entry 1lx8

View 1lx8 on RCSB PDB site
Description: Regulation of directionality in bacteriophage lambda site-specific recombination: structure of the Xis protein
Class: Viral protein
Keywords: DNA architectural protein, 'winged'-helix protein, phage excision, site-specific DNA recombination
Deposited on 2002-06-04, released 2003-06-10
The last revision prior to the SCOP 1.73 freeze date was dated 2003-06-10, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -1.96 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Excisionase
    Species: Bacteriophage lambda
    Gene: Xis
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03699 (0-54)
      • engineered (27)
    Domains in SCOP 1.73: d1lx8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lx8A (A:)
    myltlqewnarqrrprsletvrrwvresrifpppvkdgreylfhesavkvdlnrp