PDB entry 1lx8

View 1lx8 on RCSB PDB site
Description: Regulation of directionality in bacteriophage lambda site-specific recombination: structure of the Xis protein
Class: Viral protein
Keywords: DNA architectural protein, 'winged'-helix protein, phage excision, site-specific DNA recombination, Viral protein
Deposited on 2002-06-04, released 2003-06-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -1.97 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Excisionase
  Species: Enterobacteria phage lambda [TaxId:10710]
  Gene: Xis
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03699 (0-54)
    • engineered (27)
  Domains in SCOPe 2.08: d1lx8a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1lx8A (A:)
  myltlqewnarqrrprsletvrrwvresrifpppvkdgreylfhesavkvdlnrp