PDB entry 1lx6

View 1lx6 on RCSB PDB site
Description: Crystal Structure of E. Coli Enoyl Reductase-NAD+ with a Bound Benzamide Inhibitor
Class: oxidoreductase
Keywords: fabi, enoyl reductase, oxidoreductase
Deposited on 2002-06-04, released 2002-09-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.188
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1lx6a_
  • Chain 'B':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1lx6b_
  • Heterogens: NAD, ZAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lx6A (A:)
    mgflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdiv
    lqcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdis
    sysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpe
    gvrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdlsagi
    sgevvhvdggfsiaamnelelk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lx6A (A:)
    gflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdivl
    qcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdiss
    ysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpeg
    vrvnaisagpimlahceavtpirrtvtiedvgnsaaflcsdlsagisgevvhvdggfsia
    amn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lx6B (B:)
    mgflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdiv
    lqcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdis
    sysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpe
    gvrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdlsagi
    sgevvhvdggfsiaamnelelk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lx6B (B:)
    gflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdivl
    qcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdiss
    ysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpeg
    vrvnaisagpimlahceavtpirrtvtiedvgnsaaflcsdlsagisgevvhvdggfsia
    amn