PDB entry 1lwy

View 1lwy on RCSB PDB site
Description: hOgg1 Borohydride-Trapped Intermediate without 8-oxoguanine
Class: hydrolase/DNA
Keywords: DNA repair, DNA glycosylase, protein/DNA, borohydride, covalent trapping, product-assisted catalysis, reaction intermediate, hydrolase/DNA complex
Deposited on 2002-06-03, released 2003-02-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.222
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 8-oxoguanine DNA glycosylase
    Species: Homo sapiens [TaxId:9606]
    Gene: OGG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15527 (8-End)
      • cloning artifact (5-7)
    Domains in SCOPe 2.06: d1lwya1, d1lwya2, d1lwya3
  • Chain 'D':
    Compound: 5'-d(*gp*gp*tp*ap*gp*ap*cp*cp*tp*gp*gp*ap*cp*gp*c)-3'
  • Chain 'E':
    Compound: 5'-d(*gp*cp*gp*tp*cp*cp*ap*(ped)p*gp*tp*cp*tp*ap*cp*c)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lwyA (A:)
    amadigseghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqv
    wtltqteeqlhctvyrgdksqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqev
    aqkfqgvrllrqdpieclfsficssnnniaritgmverlcqafgprliqlddvtyhgfps
    lqalagpeveahlrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcil
    pgvgtkvadciclmaldkpqavpvdvhmwhiaqrdyswhpttsqakgpspqtnkelgnff
    rslwgpyagwaqavlfsadlrqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lwyA (A:)
    gseghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltq
    teeqlhctvyrsqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvr
    llrqdpieclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpslqalagpe
    veahlrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgtkva
    dciclmaldkpqavpvdvhmwhiaqrdyswhpttsqakgpspqtnkelgnffrslwgpya
    gwaqavlfsadlrq
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.